PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn377881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 616aa    MW: 66911.1 Da    PI: 7.8743
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn377881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like67.81.8e-21188237151
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 k++++Wt+ LH++F+ea++++ G e+A+Pk+ilelm+v+gLt+e+v+SHLQ
  Achn377881 188 KEKVVWTNALHNQFLEAIKSI-GFERAVPKKILELMNVPGLTRENVASHLQ 237
                 6799*****************.***************************** PP

2Response_reg65.32.8e-22129923109
                   CEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  23 yeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                    + + ++++++eal +l+ k+  +Dli++D+ mp+m+G+el k+i+ee  klp+++++a ++e+ +l+ l+ Ga  f++Kp++p++l +
    Achn377881  12 SQTIVTVKHASEALGTLRIKRgsFDLIVTDVHMPDMNGFELQKQIAEEF-KLPVVFMSADDKESVILKGLQNGAAFFIVKPISPNDLKN 99 
                   458999***********776667************************99.************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011029.7591105IPR001789Signal transduction response regulator, receiver domain
SMARTSM004486.9E-101101IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.9E-181399IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.35E-2014104No hitNo description
SuperFamilySSF521721.71E-2214108IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.7E-2514112No hitNo description
PROSITE profilePS5129410.098185244IPR017930Myb domain
SuperFamilySSF466897.35E-15185240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-21186238IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-21188239IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MAVEMDASSQ SSQTIVTVKH ASEALGTLRI KRGSFDLIVT DVHMPDMNGF ELQKQIAEEF  60
KLPVVFMSAD DKESVILKGL QNGAAFFIVK PISPNDLKNL WQYAVGKKKN KVVIEEIGNI  120
QETSQTDHRA CNKNPVQETS KNGKGSDNDV ESASSAKRNT TESKRKASAK DSSADRGENK  180
ADSATQKKEK VVWTNALHNQ FLEAIKSIGF ERAVPKKILE LMNVPGLTRE NVASHLQYVL  240
LTQLICLDDD GIKMNLQKYR IFLKRVSEAS HKIQSAAERS MIEKTFRSNF ASGHPVLVHN  300
IPRLQPFVPD EMKAPNHGNP SSANQEASSS NSTPRFGSGR SRLLCNQGNL KQPTMASVKP  360
LYCLTRLLLD ASTSGGNISG ANITEMYQPK NQVARKHFAN GFLKHNSITS GFRSPNIITH  420
HGNIGAFENP NMTVNPNCNN SNYAGYRIVG DGRLGGLGYM GAKASTDFNS NNVLITGMQN  480
GSMSTLPVLS GNSSDHLAEG ESSIGFQSGS YISPTLGNVI QQENTSVPLV PPAVKCHNIF  540
VNGGESDYSF GLLNNVSNSV SNSFPQPYGE CNLSFSFPDQ INIQSPTQLD DAEFLESVFG  600
LREYGGDDNL GGPLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-19186267364ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32902038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-54response regulator 2